Structure of PDB 9c4g Chain 1

Receptor sequence
>9c4g1 (length=44) Species: 1747 (Cutibacterium acnes) [Search protein sequence]
MKRTFQPSNRRRARNHGFRSRMSTRAGRSILAARRRKGRVNLSA
3D structure
PDB9c4g Mechanistic basis for the translation inhibition of Cutibacterium acnes by Clindamycin.
Chain1
Resolution2.53 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 M1 K2 R3 T4 F5 Q6 P7 S8 N9 R10 R11 R12 A13 R14 N15 H16 G17 F18 R19 R21 R25 A26 R34 R35 R36 K37 G38 R39 V40 M1 K2 R3 T4 F5 Q6 P7 S8 N9 R10 R11 R12 A13 R14 N15 H16 G17 F18 R19 R21 R25 A26 R34 R35 R36 K37 G38 R39 V40
External links