Structure of PDB 8s1p Chain 1

Receptor sequence
>8s1p1 (length=49) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MRVNITLACTECGERNYISKKNKRNNPDRVEFKKYCPRDKKSTLHRETK
3D structure
PDB8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
Chain1
Resolution1.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 R2 R15 Y17 I18 S19 K20 N22 N25 N26 F32 K33 K34 Y35 P37 R38 K40 R2 R15 Y17 I18 S19 K20 N22 N25 N26 F32 K33 K34 Y35 P37 R38 K40
BS02 ZN 1 C9 C12 C36 D39 C9 C12 C36 D39
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum8s1p
PubMed38811035
UniProtP56849|RL331_BACSU Large ribosomal subunit protein bL33A (Gene Name=rpmGA)

[Back to BioLiP]