Structure of PDB 8p2f Chain 1

Receptor sequence
>8p2f1 (length=61) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
GKQCFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSA
RALKSGKVTRV
3D structure
PDB8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
Chain1
Resolution2.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 G2 K3 R10 S13 T14 G15 N16 R18 S19 H20 A21 L22 N23 K26 R27 R28 W29 N30 A31 N32 Q34 K43 A51 R52 K55 S56 K58 R61 G1 K2 R9 S12 T13 G14 N15 R17 S18 H19 A20 L21 N22 K25 R26 R27 W28 N29 A30 N31 Q33 K42 A50 R51 K54 S55 K57 R60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
PDBsum8p2f
PubMed38902339
UniProtQ2FZ60|RL28_STAA8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]