Structure of PDB 8g0b Chain 1

Receptor sequence
>8g0b1 (length=81) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
PNAIITAGALIGGGLIMGGGAIGAGIGDGIAGNALISGIARQPEAQGRLF
TPFFITVGLVEAAYFINLAFMALFVFATPGL
3D structure
PDB8g0b Mechanism of mycobacterial ATP synthase inhibition by squaramides and second generation diarylquinolines.
Chain1
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 YGR 1 E65 A66 F69 E61 A62 F65
BS02 YGR 1 L63 A67 I70 L59 A63 I66
Gene Ontology
Molecular Function
GO:0008289 lipid binding
GO:0015078 proton transmembrane transporter activity
GO:0016787 hydrolase activity
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0015986 proton motive force-driven ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g0b, PDBe:8g0b, PDBj:8g0b
PDBsum8g0b
PubMed37377118
UniProtA0R205

[Back to BioLiP]