Structure of PDB 8g07 Chain 1 |
>8g071 (length=81) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] |
PNAIITAGALIGGGLIMGGGAIGAGIGDGIAGNALISGIARQPEAQGRLF TPFFITVGLVEAAYFINLAFMALFVFATPGL |
|
PDB | 8g07 Mechanism of mycobacterial ATP synthase inhibition by squaramides and second generation diarylquinolines. |
Chain | 1 |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SQC |
1 |
L63 A66 I70 |
L59 A62 I66 |
|
|
|
|