Structure of PDB 8crx Chain 1

Receptor sequence
>8crx1 (length=44) Species: 1747 (Cutibacterium acnes) [Search protein sequence]
MKRTFQPSNRRRARNHGFRSRMSTRAGRSILAARRRKGRVNLSA
3D structure
PDB8crx Sarecycline inhibits protein translation in Cutibacterium acnes 70S ribosome using a two-site mechanism.
Chain1
Resolution2.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 M1 K2 R3 T4 F5 Q6 P7 S8 N9 R10 R11 R12 A13 R14 N15 H16 G17 F18 R19 R21 R25 A26 R34 R35 R36 K37 G38 R39 V40 M1 K2 R3 T4 F5 Q6 P7 S8 N9 R10 R11 R12 A13 R14 N15 H16 G17 F18 R19 R21 R25 A26 R34 R35 R36 K37 G38 R39 V40
BS02 MG 1 T4 F5 T4 F5
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8crx, PDBe:8crx, PDBj:8crx
PDBsum8crx
PubMed36864821
UniProtA0A2B7IDI8

[Back to BioLiP]