Structure of PDB 7uvz Chain 1

Receptor sequence

>7uvz1 (length=44) Species: 480119 (Acinetobacter baumannii AB0057)

MKRTFQPSELKRKRVHGFRARMATKAGRQVLARRRAKGRHSLTV

3D structure

• PDB: 7uvz Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
• Chain: 1
• Resolution: 2.21 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1	M1 K2 R3 T4 F5 Q6 S8 E9 L10 K11 R12 K13 R14 H16 F18 R19 R21 K25 A26 Q29 R33 R34 R35 K37 G38 R39 H40	M1 K2 R3 T4 F5 Q6 S8 E9 L10 K11 R12 K13 R14 H16 F18 R19 R21 K25 A26 Q29 R33 R34 R35 K37 G38 R39 H40

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 14:59:32 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7uvz', asym_id = '1', title = 'Streptothricin F is a bactericidal antibiotic ef...eracts with the 30S subunit of the 70S ribosome. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7uvz', asym_id='1', title='Streptothricin F is a bactericidal antibiotic ef...eracts with the 30S subunit of the 70S ribosome. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7uvz', asym_id = '1'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7uvz', asym_id='1')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>