Structure of PDB 7unw Chain 1

Receptor sequence
>7unw1 (length=61) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
MKANELREKSVEQLNEQLLGLLRDQFNLRMQKATGQLGQSHLLSQVKRDI
ARVKTVLNQQA
3D structure
PDB7unw Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
Chain1
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 R7 Q39 S40 H41 R48 A51 R52 K54 T55 R7 Q39 S40 H41 R48 A51 R52 K54 T55
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7unw, PDBe:7unw, PDBj:7unw
PDBsum7unw
PubMed
UniProtQ9HWE3|RL29_PSEAE Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]