Structure of PDB 7qi6 Chain 1

Receptor sequence
>7qi61 (length=56) Species: 9606 (Homo sapiens) [Search protein sequence]
KSKSKNILVRMVSEAGTGFCFNTKRNRLREKLTLLHYDPVVKQRVLFVEK
KKIRSL
3D structure
PDB7qi6 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
Chain1
Resolution2.98 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 K12 L37 K3 L28
BS02 rna 1 K10 K14 N15 R19 C29 N31 T32 L43 L44 H45 Y46 R53 I62 R63 K1 K5 N6 R10 C20 N22 T23 L34 L35 H36 Y37 R44 I53 R54
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qi6, PDBe:7qi6, PDBj:7qi6
PDBsum7qi6
PubMed38769321
UniProtO75394|RM33_HUMAN Large ribosomal subunit protein bL33m (Gene Name=MRPL33)

[Back to BioLiP]