Structure of PDB 7q4o Chain 1

Receptor sequence
>7q4o1 (length=41) Species: 9606 (Homo sapiens) [Search protein sequence]
DPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLA
3D structure
PDB7q4o Structural basis of branch site recognition by the human spliceosome.
Chain1
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 T61 L62 S68 A71 H72 G75 T19 L20 S26 A29 H30 G33
BS02 ZN 1 C56 C59 H72 H78 C14 C17 H30 H36
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0010976 positive regulation of neuron projection development
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0016607 nuclear speck
GO:0071004 U2-type prespliceosome
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q4o, PDBe:7q4o, PDBj:7q4o
PDBsum7q4o
PubMed34822310
UniProtQ15428|SF3A2_HUMAN Splicing factor 3A subunit 2 (Gene Name=SF3A2)

[Back to BioLiP]