Structure of PDB 7po4 Chain 1

Receptor sequence
>7po41 (length=55) Species: 9606 (Homo sapiens) [Search protein sequence]
SKSKNILVRMVSEAGTGFCFNTKRNRLREKLTLLHYDPVVKQRVLFVEKK
KIRSL
3D structure
PDB7po4 Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
Chain1
Resolution2.56 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 K14 N15 R19 C29 F30 T32 K33 L43 H45 Y46 R53 I62 R63 K4 N5 R9 C19 F20 T22 K23 L33 H35 Y36 R43 I52 R53
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7po4, PDBe:7po4, PDBj:7po4
PDBsum7po4
PubMed35676484
UniProtO75394|RM33_HUMAN Large ribosomal subunit protein bL33m (Gene Name=MRPL33)

[Back to BioLiP]