Structure of PDB 7pir Chain 1

Receptor sequence
>7pir1 (length=59) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
MKVKSAAKKRFKLTKSGQIKRKHAYTSHLAPHKTTKQKRHLRKQGTVSAS
DFKRIGNLI
3D structure
PDB7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chain1
Resolution12.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 M1 K2 V3 K4 S5 A6 K9 T14 K15 S16 R21 K22 A24 Y25 T26 S27 H28 L29 A30 H32 K33 K36 Q37 K38 R39 L41 R42 K43 S48 S50 R54 M1 K2 V3 K4 S5 A6 K9 T14 K15 S16 R21 K22 A24 Y25 T26 S27 H28 L29 A30 H32 K33 K36 Q37 K38 R39 L41 R42 K43 S48 S50 R54
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pir, PDBe:7pir, PDBj:7pir
PDBsum7pir
PubMed36171285
UniProtP75447|RL35_MYCPN Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]