Structure of PDB 7of0 Chain 1

Receptor sequence
>7of01 (length=52) Species: 9606 (Homo sapiens) [Search protein sequence]
KNILVRMVSEAGTGFCFNTKRNRLREKLTLLHYDPVVKQRVLFVEKKKIR
SL
3D structure
PDB7of0 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
Chain1
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 N15 R19 F30 N31 L43 L44 H45 Y46 K51 R53 I62 R63 N2 R6 F17 N18 L30 L31 H32 Y33 K38 R40 I49 R50
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7of0, PDBe:7of0, PDBj:7of0
PDBsum7of0
PubMed34135319
UniProtO75394|RM33_HUMAN Large ribosomal subunit protein bL33m (Gene Name=MRPL33)

[Back to BioLiP]