Structure of PDB 7msh Chain 1

Receptor sequence
>7msh1 (length=48) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
VRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNCGKHQAHRET
3D structure
PDB7msh Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Chain1
Resolution3.23 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 R8 K10 H20 Y23 I24 T25 N28 N31 D32 L36 K40 F41 P43 H48 R2 K4 H14 Y17 I18 T19 N22 N25 D26 L30 K34 F35 P37 H42
BS02 ZN 1 C15 C42 C9 C36
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7msh, PDBe:7msh, PDBj:7msh
PDBsum7msh
PubMed35064151
UniProtP9WH95|RL332_MYCTU Large ribosomal subunit protein bL33B (Gene Name=rpmG2)

[Back to BioLiP]