Structure of PDB 7m4v Chain 1

Receptor sequence
>7m4v1 (length=44) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
MKRTFQPSELKRKRVHGFRARMATKAGRQVLARRRAKGRHSLTV
3D structure
PDB7m4v Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.
Chain1
Resolution2.54 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 M1 K2 R3 T4 F5 Q6 S8 E9 K11 R12 K13 R14 H16 F18 R19 R21 K25 A26 Q29 R33 R34 R35 K37 G38 R39 H40 M1 K2 R3 T4 F5 Q6 S8 E9 K11 R12 K13 R14 H16 F18 R19 R21 K25 A26 Q29 R33 R34 R35 K37 G38 R39 H40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m4v, PDBe:7m4v, PDBj:7m4v
PDBsum7m4v
PubMed34044590
UniProtB7IBH8|RL34_ACIB5 Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]