Structure of PDB 7ewk Chain 1

Receptor sequence

>7ewk1 (length=193) Species: 77009 (Hordeum vulgare subsp. spontaneum) [Search protein sequence]

EWFPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAML
CVPGVLVPEALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEF
LAIAFAEQQRTMEKDPEKKKYPGGAFDPLGFSKDPAKFEELKLKEIKNGR
LAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIVIP

3D structure

PDB

7ewk Architecture of the chloroplast PSI-NDH supercomplex in Hordeum vulgare.

Chain

Resolution

3.88 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	1	R85 Y160 P161 G162 F165 F170 L180 K181 K183 E184	R46 Y121 P122 G123 F126 F131 L141 K142 K144 E145
BS02	CLA	1	V196 G197 Y205 N225 I226	V157 G158 Y166 N186 I187
BS03	CLA	1	G57 D58 F59 G60 F61 F73 F76 K77 E80 R189	G18 D19 F20 G21 F22 F34 F37 K38 E41 R150
BS04	CLA	1	G93 V96 P97 Y121	G54 V57 P58 Y82
BS05	CLA	1	K183 K186 L190	K144 K147 L151
BS06	CLA	1	H217 L218 W222 N225 I226	H178 L179 W183 N186 I187
BS07	CLA	1	W86 R149 F165	W47 R110 F126
BS08	CHL	1	R75 S79 Y82 W86 I142 E146 Q147	R36 S40 Y43 W47 I103 E107 Q108
BS09	CLA	1	Q109 I134 E138	Q70 I95 E99
BS10	CHL	1	E40 W41 F42 P43	E1 W2 F3 P4

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ewk, PDBe:7ewk, PDBj:7ewk
PDBsum	7ewk
PubMed	34879391
UniProt	Q9SDM1\|CB121_HORVU Chlorophyll a-b binding protein 1B-21, chloroplastic (Gene Name=LHC)

[Back to BioLiP]