Structure of PDB 7ew6 Chain 1

Receptor sequence

>7ew61 (length=191) Species: 77009 (Hordeum vulgare subsp. spontaneum) [Search protein sequence]

EWFPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEIYHCRWAML
CVPGVLVPEALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEF
LAIAFAEQQRTMEKDPEKKKYPGGAFDPLGFSKDPAKFEELKLKEIKNGR
LAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIV

3D structure

PDB

7ew6 Architecture of the chloroplast PSI-NDH supercomplex in Hordeum vulgare.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	1	R85 L89 Y160 P161 G162 F165 L180 K181 E184	R46 L50 Y121 P122 G123 F126 L141 K142 E145
BS02	CLA	1	G197 V200 Q201 L214 H217 N225 I226 I229	G158 V161 Q162 L175 H178 N186 I187 I190
BS03	CLA	1	G57 D58 F59 F61 F76 K77 S79 E80 R189 M192 L193	G18 D19 F20 F22 F37 K38 S40 E41 R150 M153 L154
BS04	CLA	1	G93 L102 A108 T120 Y121 L122	G54 L63 A69 T81 Y82 L83
BS05	CLA	1	K183 K186	K144 K147
BS06	CHL	1	W105 Q109 A112 A113 E138	W66 Q70 A73 A74 E99
BS07	CLA	1	Y82 Q148 F165 P167	Y43 Q109 F126 P128
BS08	CHL	1	E78 S79 H83 I142 A143 E146 R149	E39 S40 H44 I103 A104 E107 R110
BS09	CLA	1	Q109 W111 W128 I134 I137 E138	Q70 W72 W89 I95 I98 E99
BS10	CHL	1	W41 F42 F59	W2 F3 F20

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding
GO:0046872	metal ion binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ew6, PDBe:7ew6, PDBj:7ew6
PDBsum	7ew6
PubMed	34879391
UniProt	Q9SDM1\|CB121_HORVU Chlorophyll a-b binding protein 1B-21, chloroplastic (Gene Name=LHC)

[Back to BioLiP]