Structure of PDB 6zvj Chain 1

Receptor sequence

>6zvj1 (length=576) Species: 9606 (Homo sapiens)

KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISET
LCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPG
EVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQ
NYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQ
LDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRL
KAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVTMPF
SVREGINIFLDGYVPTENLRFRDASYKYPGMKKKMGEFELAIVAGEFTDS
EIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTG
SVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVAL
ALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDF
IMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNN
YRPRINKLNSIKDVEQKKSGNYFFLD

3D structure

• PDB: 6zvj A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
• Chain: 1
• Resolution: 3.8 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1	R22 K63 P66 F67 R101 G149 S150 E151 M301 R306 E307 N310 T319 R567 R576 N578 K579 I583 K584	R19 K60 P63 F64 R98 G146 S147 E148 M298 R303 E304 N307 T316 R545 R554 N556 K557 I561 K562
BS02	SF4	1	A9 C29 C38 C55 I56 G57 C58 I60 C61	A6 C26 C35 C52 I53 G54 C55 I57 C58
BS03	SF4	1	C16 P18 C21 Q23 C25 C65 L70	C13 P15 C18 Q20 C22 C62 L67
BS04	ADP	1	Y87 N112 G113 G115 K116 S117 T118 S294	Y84 N109 G110 G112 K113 S114 T115 S291
BS05	ATP	1	R212 D216 S218 G219 G220 E221 M357 F360 G384 K385 T386 T387 H520	R209 D213 S215 G216 G217 E218 M335 F338 G362 K363 T364 T365 H498
BS06	MG	1	S117 Q171 D241	S114 Q168 D238

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0017111 ribonucleoside triphosphate phosphatase activity
• GO:0043024 ribosomal small subunit binding
• GO:0043273 CTPase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding
• GO:0060698 endoribonuclease inhibitor activity

Biological Process

• GO:0000054 ribosomal subunit export from nucleus
• GO:0006413 translational initiation
• GO:0006415 translational termination
• GO:0006417 regulation of translation
• GO:0032790 ribosome disassembly
• GO:0060702 negative regulation of endoribonuclease activity
• GO:0072344 rescue of stalled ribosome

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix
• GO:0005829 cytosol
• GO:0016020 membrane
• GO:0022626 cytosolic ribosome

External links

• PDB: RCSB:6zvj, PDBe:6zvj, PDBj:6zvj
• PDBsum: 6zvj
• PubMed: 33289941
• UniProt: P61221|ABCE1_HUMAN ATP-binding cassette sub-family E member 1 (Gene Name=ABCE1)