Structure of PDB 6zkl Chain 1

Receptor sequence

>6zkl1 (length=430) Species: 9940 (Ovis aries)

KTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILG
EVKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDR
EIIRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYE
AGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPP
FPADVGVFGCPTTVANVETVAVSPTICRRGGAWFASFGRERNSGTKLFNI
SGHVNNPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIP
KSVCETVLMDFDALIQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHES
CGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALG
DGAAWPVQGLIRHFRPELEERMQRFAQQHQ

3D structure

• PDB: 6zkl The coupling mechanism of mammalian respiratory complex I.
• Chain: 1
• Resolution: 3.1 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	1	P203 C359 G360 Q361 C362 C365 T403 I404 C405 L407	P195 C351 G352 Q353 C354 C357 T395 I396 C397 L399
BS02	FMN	1	G67 G69 K78 N96 E99 G187 E188 A223 N224 A406 L407	G59 G61 K70 N88 E91 G179 E180 A215 N216 A398 L399
BS03	NAI	1	G69 G70 A71 F73 K78 F81 E101 E189 K206 F209 T331 A406	G61 G62 A63 F65 K70 F73 E93 E181 K198 F201 T323 A398

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0046872 metal ion binding
• GO:0051287 NAD binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006120 mitochondrial electron transport, NADH to ubiquinone
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:6zkl, PDBe:6zkl, PDBj:6zkl
• PDBsum: 6zkl
• PubMed: 32972993
• UniProt: W5PUX0