Structure of PDB 6ziy Chain 1

Receptor sequence

>6ziy1 (length=437) Species: 274 (Thermus thermophilus)

TGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPD
EVIEEVKRSGLRGRGGAGFPTGLKWSFMPKDDGKQHYLICNADESEPGSF
KDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKE
ARARGYLGKNLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRL
KPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQMGTEQSKGMKL
YQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLP
FTEEVLDTPMSYEHLQAKGSMLGTGGVILIPERVSMVDAMWNLTRFYAHE
SCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFCP
LADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR

3D structure

• PDB: 6ziy Key role of quinone in the mechanism of respiratory complex I.
• Chain: 1
• Resolution: 4.25 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	1	P199 S352 C353 G354 C356 C359 C400 L402	P198 S351 C352 G353 C355 C358 C399 L401
BS02	FMN	1	R65 G66 N92 D94 Y180 G183 E184 I218 N219 N220 P401	R64 G65 N91 D93 Y179 G182 E183 I217 N218 N219 P400
BS03	NAI	1	G66 G67 F70 K75 F78 E97 Y180 E185 F205 P206	G65 G66 F69 K74 F77 E96 Y179 E184 F204 P205

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0046872 metal ion binding
• GO:0048038 quinone binding
• GO:0051287 NAD binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:6ziy, PDBe:6ziy, PDBj:6ziy
• PDBsum: 6ziy
• PubMed: 32811817
• UniProt: Q56222|NQO1_THET8 NADH-quinone oxidoreductase subunit 1 (Gene Name=nqo1)