Structure of PDB 6t59 Chain 1

Receptor sequence

>6t591 (length=36) Species: 9986 (Oryctolagus cuniculus)

MREIVHIQHGDSDLQLDRISVYYNEATGGKYVMKLV

3D structure

• PDB: 6t59 TTC5 mediates autoregulation of tubulin via mRNA degradation.
• Chain: 1
• Resolution: 3.11 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1	R46 I47 Y51 G56 G57 K58 Y59 M61 K62 L63 V64	R18 I19 Y23 G28 G29 K30 Y31 M33 K34 L35 V36

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 19:41:50 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6t59', asym_id = '1', title = 'TTC5 mediates autoregulation of tubulin via mRNA degradation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6t59', asym_id='1', title='TTC5 mediates autoregulation of tubulin via mRNA degradation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0005525,0005874,0007017', uniprot = '', pdbid = '6t59', asym_id = '1'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005525,0005874,0007017', uniprot='', pdbid='6t59', asym_id='1')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>