Structure of PDB 6s12 Chain 1

Receptor sequence
>6s121 (length=47) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
RVNVTLACTECGDRNYITTKNKRNNPERIEMKKYCPRLNKYTLHRET
3D structure
PDB6s12 Exit tunnel modulation as resistance mechanism of S. aureus erythromycin resistant mutant.
Chain1
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 R2 R15 Y17 T19 T20 N22 R24 N25 N26 M32 K33 K34 Y35 P37 N40 K41 Y42 R1 R14 Y16 T18 T19 N21 R23 N24 N25 M31 K32 K33 Y34 P36 N39 K40 Y41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s12, PDBe:6s12, PDBj:6s12
PDBsum6s12
PubMed31391518
UniProtA0A077V2P0

[Back to BioLiP]