Structure of PDB 6ha1 Chain 1

Receptor sequence
>6ha11 (length=48) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MRVNITLACTECGERNYISKKNKRNNPDRVEFKKYCPRDKKSTLHRET
3D structure
PDB6ha1 Structural basis for antibiotic resistance mediated by theBacillus subtilisABCF ATPase VmlR.
Chain1
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 R2 Y17 I18 S19 N22 N25 N26 F32 K33 K34 Y35 R38 K40 K41 R2 Y17 I18 S19 N22 N25 N26 F32 K33 K34 Y35 R38 K40 K41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ha1, PDBe:6ha1, PDBj:6ha1
PDBsum6ha1
PubMed30126986
UniProtP56849|RL331_BACSU Large ribosomal subunit protein bL33A (Gene Name=rpmGA)

[Back to BioLiP]