Structure of PDB 5l8r Chain 1

Receptor sequence

>5l8r1 (length=193) Species: 3888 (Pisum sativum) [Search protein sequence]

DWMPGQPRPSYLDGSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAML
AVPGILVPEALGLGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILVIEF
LSIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKFHEYKIKEVKNGR
LALLAFVGICVQQSAYPGTGPLENLATHLADPWHNTIGNVLIP

3D structure

PDB

5l8r Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	1	R85 M88 L89 Y160 P161 G162 F165 Y170 F177 Y180 K181 K183 E184 N187	R46 M49 L50 Y121 P122 G123 F126 Y131 F138 Y141 K142 K144 E145 N148
BS02	CLA	1	Y180 K183 N187 L190	Y141 K144 N148 L151
BS03	CLA	1	L193 G197 V200 Q201 Y205 L214 H217 I226 V229	L154 G158 V161 Q162 Y166 L175 H178 I187 V190
BS04	CLA	1	G57 D58 F59 F61 D62 L73 F76 K77 E80 R189 V196	G18 D19 F20 F22 D23 L34 F37 K38 E41 R150 V157
BS05	CLA	1	R75 F76 S79 H83	R36 F37 S40 H44
BS06	CLA	1	G93 P97 L102 A108 Y121 L122	G54 P58 L63 A69 Y82 L83
BS07	CLA	1	E179 I182 K183 K186 N187 L190	E140 I143 K144 K147 N148 L151
BS08	CLA	1	H217 P221 W222 T225	H178 P182 W183 T186
BS09	CHL	1	W105 Q109 E138	W66 Q70 E99
BS10	CLA	1	I82 R85 W86 V145 F165	I43 R46 W47 V106 F126
BS11	CHL	1	R75 E78 S79 I82 H83 W86 I142 A143 E146 R149 S150	R36 E39 S40 I43 H44 W47 I103 A104 E107 R110 S111
BS12	CLA	1	Q109 W111 W128 I134 I137 E138 I142	Q70 W72 W89 I95 I98 E99 I103
BS13	CLA	1	S203 L230 P232	S164 L191 P193
BS14	CHL	1	W41 P43 F59	W2 P4 F20
BS15	CLA	1	L66 N72 F76	L27 N33 F37
BS16	ZEX	1	V200 S203 A204	V161 S164 A165

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5l8r, PDBe:5l8r, PDBj:5l8r
PDBsum	5l8r
PubMed	28248295
UniProt	E1C9L2

[Back to BioLiP]