Structure of PDB 5jvh Chain 1

Receptor sequence
>5jvh1 (length=53) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]
AKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFR
EKK
3D structure
PDB5jvh Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
Chain1
Resolution3.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 A2 K3 D4 R7 E13 Y22 T24 T25 K26 R28 N30 T31 Q32 K38 K39 Y40 H47 A1 K2 D3 R6 E12 Y21 T23 T24 K25 R27 N29 T30 Q31 K37 K38 Y39 H46
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jvh, PDBe:5jvh, PDBj:5jvh
PDBsum5jvh
PubMed27791159
UniProtQ9RSS4|RL33_DEIRA Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]