Structure of PDB 5dm6 Chain 1

Receptor sequence
>5dm61 (length=54) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
AAAGAAPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAAHVVF
AAAA
3D structure
PDB5dm6 Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
Chain1
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 A0 P6 R7 G19 Y21 N27 N30 L37 K38 K39 Y40 A45 H46 A1 P7 R8 G20 Y22 N28 N31 L38 K39 K40 Y41 A46 H47
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dm6, PDBe:5dm6, PDBj:5dm6
PDBsum5dm6
PubMed26464437
UniProtQ9RSS4|RL33_DEIRA Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]