Structure of PDB 4wfn Chain 1

Receptor sequence
>4wfn1 (length=53) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]
AKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFR
EKK
3D structure
PDB4wfn The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.
Chain1
Resolution3.54 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 K3 D4 R7 I8 I9 Y22 T24 R28 N30 T31 K38 K39 Y40 D41 K2 D3 R6 I7 I8 Y21 T23 R27 N29 T30 K37 K38 Y39 D40
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wfn, PDBe:4wfn, PDBj:4wfn
PDBsum4wfn
PubMed28689968
UniProtQ9RSS4|RL33_DEIRA Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]