Structure of PDB 3lw5 Chain 1

Receptor sequence
>3lw51 (length=165) Species: 3888 (Pisum sativum) [Search protein sequence]
SAPGDFGFDPLGLGEVPANLERYKESELIHCRWAMLAVPGILVPEALGYG
QEWAALPGGQATYLGNPVPWGTLPTILAIEFLAIAFVEHQRSMEKDPEKK
KYPGGAFDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGT
GPLENLATHLADPWH
3D structure
PDB3lw5 Structure determination and improved model of plant photosystem I
Chain1
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA 1 E182 L183 K184 E121 L122 K123
BS02 CLA 1 G200 F201 Q204 L221 G139 F140 Q143 L160
BS03 CLA 1 A93 G96 I97 A37 G40 I41
BS04 CLA 1 R78 S82 H86 Q151 R22 S26 H30 Q90
BS05 CLA 1 Y79 A146 E149 Y23 A85 E88
BS06 CLA 1 E113 I137 E52 I76
BS07 CLA 1 A58 P59 F62 G63 G68 V72 E77 A2 P3 F6 G7 G12 V16 E21
Gene Ontology
Molecular Function
GO:0016168 chlorophyll binding
Biological Process
GO:0009416 response to light stimulus
GO:0009765 photosynthesis, light harvesting
GO:0009768 photosynthesis, light harvesting in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3lw5, PDBe:3lw5, PDBj:3lw5
PDBsum3lw5
PubMed19923216
UniProtE1C9L2

[Back to BioLiP]