Structure of PDB 2zjp Chain 1 |
>2zjp1 (length=53) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] |
AKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFR EKK |
|
PDB | 2zjp Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin. |
Chain | 1 |
Resolution | 3.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
1 |
K3 K39 |
K2 K38 |
|
|
|
|