Structure of PDB 2wsc Chain 1

Receptor sequence
>2wsc1 (length=165) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
SAPGDFGFDPLGLGEVPANLERYKESELIHCRWAMLAVPGILVPEALGYG
QEWAALPGGQATYLGNPVPWGTLPTILAIEFLAIAFVEHQRSMEKDPEKK
KYPGGAFDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGT
GPLENLATHLADPWH
3D structure
PDB2wsc Structure Determination and Improved Model of Plant Photosystem I.
Chain1
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA 1 E142 L143 K144 E121 L122 K123
BS02 CLA 1 R48 N150 R32 N129
BS03 CLA 1 G160 F161 L181 G139 F140 L160
BS04 CLA 1 K40 E43 K24 E27
BS05 CLA 1 A53 G56 A37 G40
BS06 CLA 1 R38 I45 F107 V108 R22 I29 F86 V87
BS07 CLA 1 Y39 E109 R112 Y23 E88 R91
BS08 CLA 1 E73 I97 E52 I76
BS09 CLA 1 F22 G23 G28 V32 E37 F6 G7 G12 V16 E21
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0016168 chlorophyll binding
GO:0019904 protein domain specific binding
GO:0046872 metal ion binding
Biological Process
GO:0009409 response to cold
GO:0009644 response to high light intensity
GO:0009645 response to low light intensity stimulus
GO:0009765 photosynthesis, light harvesting
GO:0009768 photosynthesis, light harvesting in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0009941 chloroplast envelope
GO:0010287 plastoglobule
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wsc, PDBe:2wsc, PDBj:2wsc
PDBsum2wsc
PubMed19923216
UniProtQ01667|CAB6_ARATH Chlorophyll a-b binding protein 6, chloroplastic (Gene Name=LHCA1)

[Back to BioLiP]