Structure of PDB 2qa4 Chain 1

Receptor sequence

>2qa41 (length=56) Species: 2238 (Haloarcula marismortui)

TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEW
QSKAGE

3D structure

• PDB: 2qa4 Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
• Chain: 1
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1	T1 G2 A3 G4 T5 P6 S7 Q8 G9 K10 K11 N12 T13 T14 T15 H16 T17 K18 R20 R21 G23 K25 S26 Y27 H28 T29 K30 K31 K32 S35 S36 K41 S42 A43 K44 R46 Y48 E49 W50 Q51 K53 A54	T1 G2 A3 G4 T5 P6 S7 Q8 G9 K10 K11 N12 T13 T14 T15 H16 T17 K18 R20 R21 G23 K25 S26 Y27 H28 T29 K30 K31 K32 S35 S36 K41 S42 A43 K44 R46 Y48 E49 W50 Q51 K53 A54

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2qa4, PDBe:2qa4, PDBj:2qa4
• PDBsum: 2qa4
• PubMed: 17599351
• UniProt: P32410|RL37_HALMA Large ribosomal subunit protein eL37 (Gene Name=rpl37e)