Structure of PDB 1sm1 Chain 1 |
>1sm11 (length=53) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] |
AKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFR EKK |
|
PDB | 1sm1 Alterations at the Peptidyl Transferase Centre of the Ribosome Induced by the Synergistic Action of the Streptogramins Dalfopristin and Quinupristin. |
Chain | 1 |
Resolution | 3.42 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
1 |
A33 K38 |
A32 K37 |
|
|
|
|