Structure of PDB 1s72 Chain 1

Receptor sequence

>1s721 (length=56) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEW
QSKAGE

3D structure

PDB

1s72 The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	1	T1 G2 A3 G4 T5 P6 S7 Q8 G9 K10 K11 N12 T13 T14 T15 H16 T17 K18 C19 R20 R21 C22 G23 K25 S26 Y27 H28 T29 K30 K31 K32 S35 F39 K41 S42 A43 K44 R45 R46 Y48 E49 W50 K53 A54	T1 G2 A3 G4 T5 P6 S7 Q8 G9 K10 K11 N12 T13 T14 T15 H16 T17 K18 C19 R20 R21 C22 G23 K25 S26 Y27 H28 T29 K30 K31 K32 S35 F39 K41 S42 A43 K44 R45 R46 Y48 E49 W50 K53 A54

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1s72, PDBe:1s72, PDBj:1s72
PDBsum	1s72
PubMed	15184028
UniProt	P32410\|RL37_HALMA Large ribosomal subunit protein eL37 (Gene Name=rpl37e)