Structure of PDB 1pd2 Chain 1

Receptor sequence

>1pd21 (length=199) Species: 10116 (Rattus norvegicus)

MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGK
IPVLEVEGLTLHQSLAIARYLTKNTDLAGKTELEQCQVDAVVDTLDDFMS
LFPWAEENQDLKERTFNDLLTRQAPHLLKDLDTYLGDKEWFIGNYVTWAD
FYWDICSTTLLVLKPDLLGIYPRLVSLRNKVQAIPAISAWILKRPQTKL

3D structure

• PDB: 1pd2 Cloning and crystal structure of hematopoietic prostaglandin D synthase.
• Chain: 1
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y8 R14 W104
• Catalytic site (residue number reindexed from 1): Y8 R14 W104
• Enzyme Commision number: 2.5.1.18: glutathione transferase.
  5.3.99.2: prostaglandin-D synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GSH	1	Y8 R14 W39 K43 K50 I51 Q63 S64	Y8 R14 W39 K43 K50 I51 Q63 S64

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004364 glutathione transferase activity
• GO:0004667 prostaglandin-D synthase activity
• GO:0005509 calcium ion binding
• GO:0016740 transferase activity
• GO:0016853 isomerase activity
• GO:0042803 protein homodimerization activity

Biological Process

• GO:0001516 prostaglandin biosynthetic process
• GO:0006693 prostaglandin metabolic process
• GO:0009624 response to nematode
• GO:0010269 response to selenium ion
• GO:2000255 negative regulation of male germ cell proliferation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1pd2, PDBe:1pd2, PDBj:1pd2
• PDBsum: 1pd2
• PubMed: 9323136
• UniProt: O35543|HPGDS_RAT Hematopoietic prostaglandin D synthase (Gene Name=Hpgds)