Structure of PDB 1nji Chain 1

Receptor sequence
>1nji1 (length=73) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGH
CGYKIAGGCYQPETVAGKAVMKA
3D structure
PDB1nji Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
Chain1
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 1 R10 G12 R13 G15 P16 R17 Y18 G19 L20 K21 I22 R23 K34 K46 R49 T52 R1 G3 R4 G6 P7 R8 Y9 G10 L11 K12 I13 R14 K25 K37 R40 T43
BS02 MG 1 R13 F14 R4 F5
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1nji, PDBe:1nji, PDBj:1nji
PDBsum1nji
PubMed12860128
UniProtP60619|RL37A_HALMA Large ribosomal subunit protein eL43 (Gene Name=rpl37ae)

[Back to BioLiP]