Structure of PDB 1g29 Chain 1

Receptor sequence

>1g291 (length=372) Species: 2265 (Thermococcus litoralis)

MAGVRLVDVWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIA
GLEEPSRGQIYIGDKLVADPEKGIFVPPKDRDIAMVFQSYALYPHMTVYD
NIAFPLKLRKVPRQEIDQRVREVAELLGLTELLNRKPRELSGGQRQRVAL
GRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQ
VEAMTMGDRIAVMNRGVLQQVGSPDEVYDKPANTFVAGFIGSPPMNFLDA
IVTEDGFVDFGEFRLKLLPDQFEVLGELGYVGREVIFGIRPEDLYDAMFA
QVRVPGENLVRAVVEIVENLGSERIVRLRVGGVTFVGSFRSESRVREGVE
VDVVFDMKKIHIFDKTTGKAIF

3D structure

• PDB: 1g29 Crystal structure of MalK, the ATPase subunit of the trehalose/maltose ABC transporter of the archaeon Thermococcus litoralis.
• Chain: 1
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 7.5.2.1: ABC-type maltose transporter.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	1	E292 D293 K359	E292 D293 K359
BS02	MG	1	D69 E71 K72	D69 E71 K72
BS03	POP	1	S38 G39 C40 G41 K42 T43 T44	S38 G39 C40 G41 K42 T43 T44
BS04	MG	1	K79 D80	K79 D80

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0015423 ABC-type maltose transporter activity
• GO:0016887 ATP hydrolysis activity
• GO:0046872 metal ion binding
• GO:0140359 ABC-type transporter activity

Biological Process

• GO:0008643 carbohydrate transport
• GO:0055085 transmembrane transport
• GO:1904981 maltose transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0043190 ATP-binding cassette (ABC) transporter complex
• GO:0055052 ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing

External links

• PDB: RCSB:1g29, PDBe:1g29, PDBj:1g29
• PDBsum: 1g29
• PubMed: 11080142
• UniProt: Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK (Gene Name=malK)