Structure of PDB 7vy2 Chain 02

Receptor sequence

>7vy202 (length=42) Species: 39723 (Cereibacter sphaeroides f. sp. denitrificans)

GYTGLTDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF

3D structure

• PDB: 7vy2 Asymmetric structure of the native Rhodobacter sphaeroides dimeric LH1-RC complex.
• Chain: 02
• Resolution: 2.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SPO	02	L19 V22 Y23 F30	L13 V16 Y17 F24
BS02	BCL	02	F30 H38	F24 H32
BS03	SPO	02	A40 W44	A34 W38
BS04	BCL	02	F30 S31 A34 I35 H38 V41 W47	F24 S25 A28 I29 H32 V35 W41

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Feb 18 20:00:49 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7vy2', asym_id = '02', title = 'Asymmetric structure of the native Rhodobacter sphaeroides dimeric LH1-RC complex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7vy2', asym_id='02', title='Asymmetric structure of the native Rhodobacter sphaeroides dimeric LH1-RC complex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016020,0019684,0030077,0045156', uniprot = '', pdbid = '7vy2', asym_id = '02'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0019684,0030077,0045156', uniprot='', pdbid='7vy2', asym_id='02')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>