Structure of PDB 9c4g Chain 0

Receptor sequence
>9c4g0 (length=50) Species: 1747 (Cutibacterium acnes) [Search protein sequence]
DVRPKITLACTECKERNYITKKNRRNNPDRMEMAKFCPRCRKHTAHRETR
3D structure
PDB9c4g Mechanistic basis for the translation inhibition of Cutibacterium acnes by Clindamycin.
Chain0
Resolution2.53 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 0 R9 K11 E21 R22 Y24 I25 K27 N29 N32 N33 M37 K41 F42 R45 K48 H49 R3 K5 E15 R16 Y18 I19 K21 N23 N26 N27 M31 K35 F36 R39 K42 H43
BS02 ZN 0 C16 C43 C10 C37
External links