Structure of PDB 8iug Chain 0

Receptor sequence
>8iug0 (length=50) Species: 120962 (Roseiflexus castenholzii) [Search protein sequence]
QNDLVPDQWKPLFNNAEWLVHDIVVKTIYGGLIIAVIAHVLCWAWTPWIR
3D structure
PDB8iug New insights on the photocomplex of Roseiflexus castenholzii revealed from comparisons of native and carotenoid-depleted complexes.
Chain0
Resolution2.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL 0 H44 W53 H39 W48
BS02 BCL 0 W14 F18 H26 Y34 W9 F13 H21 Y29
BS03 U42 0 V41 I54 V36 I49
BS04 BCL 0 A40 H44 A35 H39
BS05 BCL 0 K31 I39 K26 I34
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8iug, PDBe:8iug, PDBj:8iug
PDBsum8iug
PubMed37468106
UniProtA7NQE9

[Back to BioLiP]