Structure of PDB 8d8k Chain 0

Receptor sequence

>8d8k0 (length=429) Species: 4932 (Saccharomyces cerevisiae)

ELRLLSKTLQGQSYRDQLELNPDVSKAINNNIMAVHIPNNLRRVATNYYK
EIQEPNSLHRPCRTKMEVDAHIASIFLQNYGSIFQSLKELQKRVGPDNFK
PQRILDVGYGPATGIVALNDILGPNYRPDLKDAVILGNAEMQERAKIILS
RQLIMTNLRSSIPASKEYDLIILTHQLLHDGNQFPIQVDENIEHYLNILA
PGGHIVIIERGNPMGFEIIARARQITLRPENFPDEFGKIPRPWNYFLKVI
APCPHQRKCPLQVGNPNFYTHKEGKDLKFCNFQKSIKRPKFSIELKKGKL
LATSWDNGRDYEILNYSYLIFERSHKDENTLKEIKKLRNENVNGKYDIGS
LGDDTQNSWPRIINDPVKRKGHVMMDLCAPSGELEKWTVSRSFSKQIYHD
ARKSKKGDLWASAAKTQIKGLGDLNVKKF

3D structure

• PDB: 8d8k Principles of mitoribosomal small subunit assembly in eukaryotes.
• Chain: 0
• Resolution: 3.13 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	0	H119 R123 I135 Q138 D281 Q284 I287 R311 P314 N387 K392 K398 R408 K416 K417 L421 T423 S424 W425 N442 G443 R444 D445 Y446 N450 N499 D500 R504 K505 H507 D511 K521 R537	H59 R63 I75 Q78 D180 Q183 I186 R210 P213 N267 K272 K278 R288 K296 K297 L301 T303 S304 W305 N307 G308 R309 D310 Y311 N315 N364 D365 R369 K370 H372 D376 K386 R402
BS02	SF4	0	R324 P372 C373 H375 C379 P380 L381 C400 C513	R223 P252 C253 H255 C259 P260 L261 C280 C378

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008168 methyltransferase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation
• GO:0180026 mitochondrial small ribosomal subunit assembly

Cellular Component

• GO:0005739 mitochondrion
• GO:0005763 mitochondrial small ribosomal subunit

External links

• PDB: RCSB:8d8k, PDBe:8d8k, PDBj:8d8k
• PDBsum: 8d8k
• PubMed: 36482135
• UniProt: P36056|RT22_YEAST Ribosome assembly protein RSM22, mitochondrial (Gene Name=RSM22)