Structure of PDB 8crx Chain 0

Receptor sequence
>8crx0 (length=50) Species: 1747 (Cutibacterium acnes) [Search protein sequence]
DVRPKITLACTECKERNYITKKNRRNNPDRMEMAKFCPRCRKHTAHRETR
3D structure
PDB8crx Sarecycline inhibits protein translation in Cutibacterium acnes 70S ribosome using a two-site mechanism.
Chain0
Resolution2.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 0 R9 E21 R22 Y24 I25 T26 K27 N29 N32 M37 M39 K41 F42 R45 K48 H49 R3 E15 R16 Y18 I19 T20 K21 N23 N26 M31 M33 K35 F36 R39 K42 H43
BS02 ZN 0 C16 C19 C43 C10 C13 C37
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8crx, PDBe:8crx, PDBj:8crx
PDBsum8crx
PubMed36864821
UniProtA0A2C6LJM0

[Back to BioLiP]