Structure of PDB 8ccs Chain 0

Receptor sequence

>8ccs0 (length=134) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAE
KDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVE
KASRQQRKQKKNRDKKIFGTGKRLAKKVARRNAD

3D structure

PDB

8ccs Cryo-EM analysis of eukaryotic ribosome translocation intermediates

Chain

Resolution

1.97 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	0	I7 R8 R10 K11 V12 K21 A33 N34 K37 K49 F58 G59 F60 R61 T62 Q63 F64 G65 G66 Y89 R93 R105 Q106 K109 Q110 K112 N113 K116 K117 F119 G120 T121 K123 R124 K127 K128 R131 R132	I6 R7 R9 K10 V11 K20 A32 N33 K36 K48 F57 G58 F59 R60 T61 Q62 F63 G64 G65 Y88 R92 R104 Q105 K108 Q109 K111 N112 K115 K116 F118 G119 T120 K122 R123 K126 K127 R130 R131

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8ccs, PDBe:8ccs, PDBj:8ccs
PDBsum	8ccs
PubMed	38030725
UniProt	P0CX31\|RS24A_YEAST Small ribosomal subunit protein eS24A (Gene Name=RPS24A)