Structure of PDB 7qv1 Chain 0

Receptor sequence
>7qv10 (length=54) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
AVPFRRTSKMKKRLRRTHFKLNVPGMTECPSCGEMKLSHRVCKACGSYNG
KDIN
3D structure
PDB7qv1 Bacterial ribosome collision sensing by a MutS DNA repair ATPase paralogue.
Chain0
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 0 A2 V3 P4 F5 R6 R7 T8 M11 K12 K13 R14 L15 R16 R17 T18 H19 F20 K21 E29 P31 S39 H40 R41 Y49 N50 A1 V2 P3 F4 R5 R6 T7 M10 K11 K12 R13 L14 R15 R16 T17 H18 F19 K20 E28 P30 S38 H39 R40 Y48 N49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qv1, PDBe:7qv1, PDBj:7qv1
PDBsum7qv1
PubMed35264791
UniProtO34687|RL32_BACSU Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]