Structure of PDB 7q0f Chain 0

Receptor sequence

>7q0f0 (length=171) Species: 237561 (Candida albicans SC5314) [Search protein sequence]

SRLNEYQVIGRNLPTESVPEPKLFRMRIFAPNTVVAKSRYWYFLQKLHKV
KKASGEIVSVNIISEAKPTKVKTFGIWLRYESRSGIHNMYKEYRDVTRVG
AVETMYQDLAARHRARFRSIHILKVVELEKTDDVKRQYVKQFLTKDLKFP
LPHRVQKSKKLFQATAPTTFY

3D structure

PDB

7q0f E-site drug specificity of the human pathogen Candida albicans ribosome.

Chain

Resolution

2.64 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	0	N62 S65 E66 A67 K68 P69 K71 S83 R84 S85 H88 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 R137 Y139 L144 K146 H154 R155 S159 K161 Q164 A165 P168 T169 T170 F171	N61 S64 E65 A66 K67 P68 K70 S82 R83 S84 H87 M89 Y90 K91 Q107 A110 A111 R112 H113 R114 R116 T131 R136 Y138 L143 K145 H153 R154 S158 K160 Q163 A164 P167 T168 T169 F170
BS02	rna	0	S39 R40 Y43 Q46 H49 K50 K52 K53 E82 R84 R119	S38 R39 Y42 Q45 H48 K49 K51 K52 E81 R83 R118

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0009986	cell surface
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7q0f, PDBe:7q0f, PDBj:7q0f
PDBsum	7q0f
PubMed	35613268
UniProt	A0A1D8PLC9\|RL20B_CANAL Large ribosomal subunit protein eL20 (Gene Name=RPL20B)

[Back to BioLiP]