Structure of PDB 7pir Chain 0

Receptor sequence
>7pir0 (length=47) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
MKRTYQPSKLKRAKTHGFLARMATASGRKVLKLRRKKQRAQLTVSSE
3D structure
PDB7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chain0
Resolution12.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 0 M1 K2 R3 T4 Y5 Q6 K9 K11 T15 H16 F18 R21 R34 R35 K36 K37 Q38 R39 A40 Q41 V44 S45 S46 E47 M1 K2 R3 T4 Y5 Q6 K9 K11 T15 H16 F18 R21 R34 R35 K36 K37 Q38 R39 A40 Q41 V44 S45 S46 E47
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pir, PDBe:7pir, PDBj:7pir
PDBsum7pir
PubMed36171285
UniProtP78006|RL34_MYCPN Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]