Structure of PDB 7pib Chain 0

Receptor sequence
>7pib0 (length=47) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
MKRTYQPSKLKRAKTHGFLARMATASGRKVLKLRRKKQRAQLTVSSE
3D structure
PDB7pib Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chain0
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 0 R3 T4 Y5 Q6 P7 S8 K9 K11 R12 K14 T15 H16 F18 R21 S26 K29 K32 R34 R35 K36 K37 Q38 R39 A40 L42 S45 R3 T4 Y5 Q6 P7 S8 K9 K11 R12 K14 T15 H16 F18 R21 S26 K29 K32 R34 R35 K36 K37 Q38 R39 A40 L42 S45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pib, PDBe:7pib, PDBj:7pib
PDBsum7pib
PubMed36171285
UniProtP78006|RL34_MYCPN Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]