Structure of PDB 6nu2 Chain 0

Receptor sequence
>6nu20 (length=108) Species: 9606 (Homo sapiens) [Search protein sequence]
AAPKNRRTIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHVLCAYCYE
KVCKETAEIRRQIGKQEGGPFKAPTIETVVLYTGETPSEQDQGKRIIERD
RKRPSWFT
3D structure
PDB6nu2 Structural insights into unique features of the human mitochondrial ribosome recycling.
Chain0
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 0 A79 A80 P81 K82 N83 R84 R85 T86 I87 V89 N90 R91 C92 R93 R95 N96 Q98 N106 K119 H120 A135 R138 R139 G142 F149 A1 A2 P3 K4 N5 R6 R7 T8 I9 V11 N12 R13 C14 R15 R17 N18 Q20 N28 K41 H42 A57 R60 R61 G64 F71
BS02 ZN 0 E112 C123 E34 C45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0015934 large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nu2, PDBe:6nu2, PDBj:6nu2
PDBsum6nu2
PubMed30962385
UniProtQ9BYC8|RM32_HUMAN Large ribosomal subunit protein bL32m (Gene Name=MRPL32)

[Back to BioLiP]