Structure of PDB 6lqm Chain 0

Receptor sequence

>6lqm0 (length=66) Species: 9606 (Homo sapiens)

MELILPSGARVGHRSLMRYYKQRTGAALMRERDMQYVQRMKSKWMLKTGM
KNNATKQMHFRVQVRF

3D structure

• PDB: 6lqm Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
• Chain: 0
• Resolution: 3.09 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	0	R394 R403 R443 Y447 Q449 N464 Q468 H470 F471 R472 Q474 V475 R476 F477	R14 R23 R32 Y36 Q38 N53 Q57 H59 F60 R61 Q63 V64 R65 F66

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding
• GO:1990275 preribosome binding

Biological Process

• GO:0008631 intrinsic apoptotic signaling pathway in response to oxidative stress
• GO:0033674 positive regulation of kinase activity
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis
• GO:0043065 positive regulation of apoptotic process
• GO:0043410 positive regulation of MAPK cascade
• GO:0046330 positive regulation of JNK cascade

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005794 Golgi apparatus
• GO:0005829 cytosol
• GO:0030687 preribosome, large subunit precursor

External links

• PDB: RCSB:6lqm, PDBe:6lqm, PDBj:6lqm
• PDBsum: 6lqm
• PubMed: 32669547
• UniProt: Q969S3|ZN622_HUMAN Cytoplasmic 60S subunit biogenesis factor ZNF622 (Gene Name=ZNF622)