Structure of PDB 6igz Chain 0

Receptor sequence

>6igz0 (length=202) Species: 325651 (Bryopsis corticulans) [Search protein sequence]

RPMWYPGATAPKHLDGSMLGDYGYDPLDLGANPDSLAWFREAELMNGRYA
MLGVMGGAFVNAFGLPNWWEAGAKVDVPISLGVLIALELAIFAVFEYKRY
EGFKKTGECGVLSFMPFDPLNMRSEENKLKELKNGRLAMVASVGFISQYL
VTGKGPVDNLKDHIVDPLHNNIYTSSVGNEVTVAIVFAAMWPMFAEAKKA
LG

3D structure

PDB

6igz Structure of a green algal photosystem I in complex with a large number of light-harvesting complex I subunits.

Chain

Resolution

3.49 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	0	P34 W36 Y37 Y54 Y56 P224	P2 W4 Y5 Y22 Y24 P192
BS02	CLA	0	L46 G52 D53 Y54 G55 Y56 L61 G62 F71 R72 E75 R168 M171 V172	L14 G20 D21 Y22 G23 Y24 L29 G30 F39 R40 E43 R136 M139 V140
BS03	CLA	0	W70 N78	W38 N46
BS04	CLA	0	L84 G88 P98	L52 G56 P66
BS05	CLA	0	Y81 E120 F124	Y49 E88 F92
BS06	CHL	0	G104 A105 L116 I117 E120	G72 A73 L84 I85 E88
BS07	CLA	0	S67 W70 A74 M77 Y81 F124 E128 Y132	S35 W38 A42 M45 Y49 F92 E96 Y100
BS08	CLA	0	R80 M83 L84 V143 L144 F146 E157 K160 E163	R48 M51 L52 V111 L112 F114 E125 K128 E131
BS09	CLA	0	K162 K165 N166	K130 K133 N134
BS10	CLA	0	R155 K162 N166	R123 K130 N134
BS11	CLA	0	V172 A173 V175 G176 S179 Q180 V183 N191 H195 N202 N203 I204	V140 A141 V143 G144 S147 Q148 V151 N159 H163 N170 N171 I172
BS12	CLA	0	H195 I196 P199 N203	H163 I164 P167 N171
BS13	CLA	0	S179 L182 V209 E212 V213 A216	S147 L150 V177 E180 V181 A184

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6igz, PDBe:6igz, PDBj:6igz
PDBsum	6igz
PubMed	30850820
UniProt	A0A4V8H004

[Back to BioLiP]