Structure of PDB 5v7q Chain 0

Receptor sequence
>5v7q0 (length=53) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
AVPKRRKSRSNTRSRRSQWKAAKTELVGVTVAGHAHKVPRRLLKAARLGL
IDF
3D structure
PDB5v7q Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.
Chain0
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 0 A2 V3 P4 K5 R6 R7 K8 S9 R10 S11 N12 T13 R14 S15 R16 R17 S18 Q19 W20 L27 V28 R41 R48 A1 V2 P3 K4 R5 R6 K7 S8 R9 S10 N11 T12 R13 S14 R15 R16 S17 Q18 W19 L26 V27 R40 R47
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5v7q, PDBe:5v7q, PDBj:5v7q
PDBsum5v7q
PubMed28977617
UniProtP9WH99|RL32_MYCTU Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]